Antibodies

View as table Download

GPR111 (ADGRF2) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 365-394 amino acids from the Central region of human GP11

Rabbit Polyclonal Anti-GPR111 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GPR111 Antibody is: synthetic peptide directed towards the N-terminal region of Human GPR111. Synthetic peptide located within the following region: TESCRTLYQAASKSKEKVPARPHGVCDGVCTDYSQCTQPCPPDTQGNMGF