GPR111 (ADGRF2) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 365-394 amino acids from the Central region of human GP11 |
GPR111 (ADGRF2) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 365-394 amino acids from the Central region of human GP11 |
Rabbit Polyclonal Anti-GPR111 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPR111 Antibody is: synthetic peptide directed towards the N-terminal region of Human GPR111. Synthetic peptide located within the following region: TESCRTLYQAASKSKEKVPARPHGVCDGVCTDYSQCTQPCPPDTQGNMGF |