GPR111 (ADGRF2) Rabbit Polyclonal Antibody

CAT#: TA331605

Rabbit Polyclonal Anti-GPR111 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ADGRF2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-GPR111 Antibody is: synthetic peptide directed towards the N-terminal region of Human GPR111. Synthetic peptide located within the following region: TESCRTLYQAASKSKEKVPARPHGVCDGVCTDYSQCTQPCPPDTQGNMGF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 78 kDa
Gene Name adhesion G protein-coupled receptor F2
Background GPR111 is a orphan receptor.
Synonyms GPR111; hGPCR35; PGR20
Note Immunogen sequence homology: Human: 100%; Horse: 85%; Dog: 77%
Reference Data
Protein Families Druggable Genome, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.