Antibodies

Jump to Filters
View as table Download
AGFG2 Rabbit Polyclonal Antibody
AP21188PU-N

USD 370.00

2 Weeks

AGFG2 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
AGFG2 Rabbit Polyclonal Antibody
TA332045

USD 375.00

5 Days

Rabbit Polyclonal Anti-AGFG2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AGFG2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AGFG2. Synthetic peptide located within the following region: NEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKG