Rabbit Polyclonal Anti-AKAP8L Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKAP8L antibody: synthetic peptide directed towards the C terminal of human AKAP8L. Synthetic peptide located within the following region: APGAVSPPPPPPPEEEEEGAVPLLGGALQRQIRGIPGLDVEDDEEGGGGA |
Rabbit Polyclonal anti-AKAP8L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AKAP8L antibody is: synthetic peptide directed towards the C-terminal region of Human AKAP8L. Synthetic peptide located within the following region: NNKLISKKLERYLKGENPFTDSPEEEKEQEEAEGGALDEGAQGEAAGISE |
Rabbit Polyclonal Anti-AKAP8L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AKAP8L antibody: synthetic peptide directed towards the middle region of human AKAP8L. Synthetic peptide located within the following region: ALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFY |
Anti-AKAP8L rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human |
Germany
Japan
United Kingdom
China
