AKAP8L Rabbit Polyclonal Antibody
Other products for "AKAP8L"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-AKAP8L antibody: synthetic peptide directed towards the middle region of human AKAP8L. Synthetic peptide located within the following region: ALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 72 kDa |
Gene Name | A-kinase anchoring protein 8 like |
Database Link | |
Background | AKAP8L could play a role in constitutive transport element (CTE)-mediated gene expression. It does not seem to be implicated in the binding of regulatory subunit II of PKA. It may be involved in nuclear envelope breakdown and chromatin condensation. It may regulate the initiation phase of DNA replication when associated with TMPO-beta. |
Synonyms | HA95; HAP95; NAKAP; NAKAP95 |
Note | Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.