Rabbit Polyclonal Anti-Amigo2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Amigo2 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FHALGFIHEAQVGERAIVHCDGKTGNGNTDFIWVGPDNRLLEPDKDTGNF |
Rabbit Polyclonal Anti-AMIGO2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AMIGO2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AMIGO2. Synthetic peptide located within the following region: LSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLKCLDL |
Rabbit Polyclonal Anti-AMIGO2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AMIGO2 |
Germany
Japan
United Kingdom
China