Amigo2 Rabbit Polyclonal Antibody

CAT#: TA333380

Rabbit Polyclonal Anti-Amigo2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Amigo2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Amigo2 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FHALGFIHEAQVGERAIVHCDGKTGNGNTDFIWVGPDNRLLEPDKDTGNF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 57 kDa
Gene Name adhesion molecule with Ig like domain 2
Background Amigo2 is required for depolarization-dependent survival of cultured cerebellar granule neurons. It may mediate homophilic as well as heterophilic cell-cell interaction with AMIGO1 or AMIGO3. It also may contribute to signal transduction through its intracellular domain.
Synonyms ALI1; Alivin-1; AMIGO-2; DEGA
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Horse: 93%; Guinea pig: 93%; Rabbit: 85%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.