Rabbit Polyclonal Anti-Ap4s1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ap4s1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ap4s1. Synthetic peptide located within the following region: KFFLMVNKQGQTRLSKYYEHVDINKRALLETEVSKSCLSRSSEQCSFIEY |
Rabbit Polyclonal Anti-Ap4s1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Ap4s1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Ap4s1. Synthetic peptide located within the following region: VSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVGVNDTENEMAIYEFI |
Germany
Japan
United Kingdom
China