Ap4s1 Rabbit Polyclonal Antibody

CAT#: TA340150

Rabbit Polyclonal Anti-Ap4s1 Antibody

Product Images

Host: Rabbit; Target Name: Ap4s1; Sample Tissue: Mouse Stomach lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ap4s1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Ap4s1. Synthetic peptide located within the following region: KFFLMVNKQGQTRLSKYYEHVDINKRALLETEVSKSCLSRSSEQCSFIEY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: adaptor-related protein complex AP-4, sigma 1
• Database Link:
  NP_068356
  Entrez Gene 11782 Mouse
  UniProt ID Q9WVL1
• Background: Ap4s1 is a subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system.
• Synonyms: AP47B; CLA20; CLAPS4; FLJ32366; Sigma4-adaptin
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 86%; Yeast: 75%