Antibodies

Jump to Filters
View as table Download
AQP12 (AQP12A) Rabbit Polyclonal Antibody
TA316392

USD 345.00

In Stock

Rabbit polyclonal anti-AQP12 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AQP12.
AQP12 (AQP12A) Rabbit Polyclonal Antibody
TA334879

USD 375.00

5 Days

Rabbit Polyclonal Anti-AQP12A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AQP12A antibody is: synthetic peptide directed towards the C-terminal region of Human AQP12A. Synthetic peptide located within the following region: RLPHLFQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVE