AQP12 (AQP12A) Rabbit Polyclonal Antibody

CAT#: TA334879

Rabbit Polyclonal Anti-AQP12A Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "AQP12A"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-AQP12A antibody is: synthetic peptide directed towards the C-terminal region of Human AQP12A. Synthetic peptide located within the following region: RLPHLFQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSGVE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 32 kDa
Gene Name aquaporin 12A
Background Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
Synonyms AQP-12; AQP12; AQPX2
Note Immunogen Sequence Homology: Human: 100%; Horse: 79%; Mouse: 79%; Rat: 77%; Bovine: 75%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.