Rabbit Polyclonal Anti-ARHGAP36 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARHGAP36 antibody: synthetic peptide directed towards the N terminal of human ARHGAP36. Synthetic peptide located within the following region: KPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKH |
Rabbit Polyclonal Anti-ARHGAP36 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARHGAP36 antibody: synthetic peptide directed towards the middle region of human ARHGAP36. Synthetic peptide located within the following region: EDALLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGA |
Germany
Japan
United Kingdom
China