ARHGAP36 Rabbit Polyclonal Antibody

CAT#: TA340369

Rabbit Polyclonal Anti-ARHGAP36 Antibody

Product Images

WB Suggested Anti-ARHGAP36 Antibody; Titration: 1 ug/ml; Positive Control: MCF7 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ARHGAP36 antibody: synthetic peptide directed towards the N terminal of human ARHGAP36. Synthetic peptide located within the following region: KPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: Rho GTPase activating protein 36
• Database Link:
  NP_659404
  Entrez Gene 158763 Human
  UniProt ID Q6ZRI8
• Background: ARHGAP36 is the GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
• Synonyms: RP13-102H20.1
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rabbit: 93%; Mouse: 86%; Pig: 83%; Goat: 79%; Sheep: 79%

Reference Data

• Protein Families: Transmembrane