Antibodies

View as table Download

ARHGAP45 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ARHGAP45

Rabbit Polyclonal Anti-HMHA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMHA1 antibody is: synthetic peptide directed towards the N-terminal region of Human HMHA1. Synthetic peptide located within the following region: MMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEP

ARHGAP45 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ARHGAP45

ARHGAP45 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human ARHGAP45 (NP_036424.2).
Modifications Unmodified