HA1 (ARHGAP45) Rabbit Polyclonal Antibody

CAT#: TA334447

Rabbit Polyclonal Anti-HMHA1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ARHGAP45"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HMHA1 antibody is: synthetic peptide directed towards the N-terminal region of Human HMHA1. Synthetic peptide located within the following region: MMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 84 kDa
Gene Name histocompatibility (minor) HA-1
Background The function of this protein remains unknown.
Synonyms HA-1; HLA-HA1; HMHA1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 92%; Horse: 75%; Rabbit: 75%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.