HA1 (ARHGAP45) Rabbit Polyclonal Antibody

CAT#: TA334447

Rabbit Polyclonal Anti-HMHA1 Antibody

Product Images

Host: Rabbit; Target Name: HMHA1; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HMHA1 antibody is: synthetic peptide directed towards the N-terminal region of Human HMHA1. Synthetic peptide located within the following region: MMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 84 kDa
• Gene Name: histocompatibility (minor) HA-1
• Database Link:
  NP_001245257
  Entrez Gene 23526 Human
  UniProt ID Q92619
• Background: The function of this protein remains unknown.
• Synonyms: HA-1; HLA-HA1; HMHA1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 92%; Horse: 75%; Rabbit: 75%