Antibodies

Jump to Filters
View as table Download
SGEF (ARHGEF26) Rabbit Polyclonal Antibody
TA333805

USD 375.00

5 Days

Rabbit Polyclonal Anti-ARHGEF26 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARHGEF26 Antibody: synthetic peptide directed towards the N terminal of human SGEF. Synthetic peptide located within the following region: MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLITD
SGEF (ARHGEF26) Rabbit Polyclonal Antibody
TA373663

USD 220.00

3 Weeks

ARHGEF26 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 592-871 of human ARHGEF26 (NP_056410.3).
Modifications Unmodified