Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-AS3MT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AS3MT antibody: synthetic peptide directed towards the middle region of human AS3MT. Synthetic peptide located within the following region: GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL |
Cyt 19 (AS3MT) (N-term) goat polyclonal antibody, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Synthetic peptide (AALRDAEIQKDVQ-C) from N-terminus of human AS3MT |
AS3MT rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human AS3MT |
AS3MT Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 216-375 of human AS3MT (NP_065733.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- AS3MT