Cyt 19 (AS3MT) Rabbit Polyclonal Antibody

CAT#: TA346809

Rabbit Polyclonal Anti-AS3MT Antibody

Product Images

WB Suggested Anti-AS3MT Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AS3MT antibody: synthetic peptide directed towards the middle region of human AS3MT. Synthetic peptide located within the following region: GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42
• Gene Name: arsenite methyltransferase
• Database Link:
  NP_065733
  Entrez Gene 57412 Human
  UniProt ID Q9HBK9
• Background: AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism (Lin et al., 2002 [PubMed 11790780]). [supplied by OMIM, Mar 2008]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC119637.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: CYT19
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Rat: 92%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome