Antibodies

Jump to Filters
View as table Download
ASB5 Rabbit Polyclonal Antibody
TA342096

USD 375.00

5 Days

Rabbit Polyclonal Anti-ASB5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASB5 antibody: synthetic peptide directed towards the C terminal of human ASB5. Synthetic peptide located within the following region: LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC
ASB5 Rabbit Polyclonal Antibody
TA373724

USD 220.00

3 Weeks

ASB5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 130-329 of human ASB5 (NP_543150.1).
Modifications Unmodified