ASB5 Rabbit Polyclonal Antibody
Other products for "ASB5"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ASB5 antibody: synthetic peptide directed towards the C terminal of human ASB5. Synthetic peptide located within the following region: LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 36 kDa |
Gene Name | ankyrin repeat and SOCS box containing 5 |
Database Link | |
Background | ASB5 is a member ofThe¡¡ankyrin repeat and SOCS box-containing (ASB) family of proteins.¡¡They contain ankyrin repeat sequence and SOCS box domain.The SOCS¡¡box serves to couple suppressor of cytokine signalling (SOCS)¡¡proteins andTheir binding partners withThe elongin B and C¡¡complex, possibly targetingThem for degradation.The protein encoded byThis gene is a member ofThe ankyrin repeat and SOCS box-containing (ASB) family of proteins.They contain ankyrin repeat sequence and SOCS box domain.The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins andTheir binding partners withThe elongin B and C complex, possibly targetingThem for degradation. Multiple alternatively spliced transcript variants have been described forThis gene butTheir full length sequences are not known. |
Synonyms | ASB-5 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.