ASB5 Rabbit Polyclonal Antibody

CAT#: TA342096

Rabbit Polyclonal Anti-ASB5 Antibody

Product Images

WB Suggested Anti-ASB5 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ASB5 antibody: synthetic peptide directed towards the C terminal of human ASB5. Synthetic peptide located within the following region: LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: ankyrin repeat and SOCS box containing 5
• Database Link:
  NP_543150
  Entrez Gene 140458 Human
  UniProt ID Q8WWX0
• Background: ASB5 is a member ofThe¡¡ankyrin repeat and SOCS box-containing (ASB) family of proteins.¡¡They contain ankyrin repeat sequence and SOCS box domain.The SOCS¡¡box serves to couple suppressor of cytokine signalling (SOCS)¡¡proteins andTheir binding partners withThe elongin B and C¡¡complex, possibly targetingThem for degradation.The protein encoded byThis gene is a member ofThe ankyrin repeat and SOCS box-containing (ASB) family of proteins.They contain ankyrin repeat sequence and SOCS box domain.The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins andTheir binding partners withThe elongin B and C complex, possibly targetingThem for degradation. Multiple alternatively spliced transcript variants have been described forThis gene butTheir full length sequences are not known.
• Synonyms: ASB-5
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transmembrane