Germany
Japan
United Kingdom
China
Goat Anti-Ascl3 (mouse) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HLPEDYLEKRLSK, from the internal region of the protein sequence according to NP_064435.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ASCL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASCL3 antibody: synthetic peptide directed towards the C terminal of human ASCL3. Synthetic peptide located within the following region: PEEYLEKRLSKVETLRAAIKYINYLQSLLYPDKAETKNNPGKVSSMIATT |
Rabbit Polyclonal Anti-Ascl3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ascl3 antibody: synthetic peptide directed towards the middle region of mouse Ascl3. Synthetic peptide located within the following region: GYARLRRHLPEDYLEKRLSKVETLRAAIKYISYLQSLLYPDESETKKNPR |
USD 465.00
4 Weeks
Carrier-free (BSA/glycerol-free) ASCL3 mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 379.00
In Stock
ASCL3 mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ASCL3 mouse monoclonal antibody,clone OTI1C5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
ASCL3 mouse monoclonal antibody,clone OTI1C5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 159.00
2 Days
ASCL3 mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- ASCL3