Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-ATF6B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATF6B Antibody: A synthesized peptide derived from human ATF6B |
Antibodies
View as table Download
Rabbit polyclonal anti-ATF6B antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATF6B. |
Rabbit Polyclonal Anti-CREBL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREBL1 antibody: synthetic peptide directed towards the N terminal of human CREBL1. Synthetic peptide located within the following region: EIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPF |
Rabbit Polyclonal anti-CREBL1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREBL1 antibody: synthetic peptide directed towards the middle region of human CREBL1. Synthetic peptide located within the following region: FNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQPRKKSPPVKAVP |
ATF6B rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATF6B |
ATF6B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ATF6B |
Active filters
Target Symbol
- ATF6B