Rabbit Polyclonal Anti-XRCC6BP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-XRCC6BP1 Antibody is: synthetic peptide directed towards the C-terminal region of Human XRCC6BP1. Synthetic peptide located within the following region: NISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYS |
Carrier-free (BSA/glycerol-free) XRCC6BP1 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ATP23 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-246 of human ATP23 (NP_150592.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
XRCC6BP1 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
XRCC6BP1 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
XRCC6BP1 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
XRCC6BP1 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
