XRCC6BP1 (ATP23) Rabbit Polyclonal Antibody

CAT#: TA333586

Rabbit Polyclonal Anti-XRCC6BP1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "ATP23"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-XRCC6BP1 Antibody is: synthetic peptide directed towards the C-terminal region of Human XRCC6BP1. Synthetic peptide located within the following region: NISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 27 kDa
Gene Name ATP23 metallopeptidase and ATP synthase assembly factor homolog (S. cerevisiae)
Background The function of this protein remains unknown.
Synonyms KUB3; XRCC6BP1
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 92%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.