Rabbit Polyclonal Anti-AAMDC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AAMDC Antibody: synthetic peptide directed towards the middle region of human AAMDC. Synthetic peptide located within the following region: SEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHST |
Rabbit Polyclonal Anti-Aamdc Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Aamdc Antibody is: synthetic peptide directed towards the N-terminal region of Rat Aamdc. Synthetic peptide located within the following region: IASLSWGQMKVQGSTLTYKDCKVWPGGSRAWDWRETGTEHSPGVQPADVK |
Carrier-free (BSA/glycerol-free) C11orf67 mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C11orf67 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C11orf67 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C11orf67 mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) C11orf67 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
C11orf67 mouse monoclonal antibody,clone 1C4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
C11orf67 mouse monoclonal antibody,clone 1C4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI1C4 (formerly 1C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
C11orf67 mouse monoclonal antibody,clone 1G1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
C11orf67 mouse monoclonal antibody,clone 1G1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
C11orf67 mouse monoclonal antibody,clone 1H5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
C11orf67 mouse monoclonal antibody,clone 1H5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI4C1 (formerly 4C1), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI4C1 (formerly 4C1), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI4C1 (formerly 4C1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
C11orf67 mouse monoclonal antibody,clone 5E4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
5 Days
C11orf67 mouse monoclonal antibody,clone 5E4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
C11orf67 (AAMDC) mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China