Antibodies

Jump to Filters
View as table Download
MRP2 (ABCC2) Rabbit Polyclonal Antibody
TA313641

USD 345.00

In Stock

Rabbit polyclonal anti-ABCC2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCC2.
MRP2 (ABCC2) Rabbit Polyclonal Antibody
TA332361

USD 375.00

5 Days

Rabbit Polyclonal Anti-Abcc2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Abcc2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA
MRP2 (ABCC2) Mouse Monoclonal Antibody [Clone ID: OTI5C3]
CF812520

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ABCC2 mouse monoclonal antibody,clone OTI5C3

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
MRP2 (ABCC2) Rabbit Polyclonal Antibody
TA350710

USD 345.00

In Stock

Rabbit Polyclonal Anti-ABCC2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABCC2
ABCC2 Rabbit Polyclonal Antibody
TA368704

USD 380.00

4 Weeks

ABCC2 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABCC2
MRP2 (ABCC2) Rabbit Polyclonal Antibody
TA373137

USD 410.00

3 Weeks

MRP2/ABCC2 Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified
MRP2 (ABCC2) Mouse Monoclonal Antibody [Clone ID: OTI5C3]
TA812520

USD 447.00

In Stock

ABCC2 mouse monoclonal antibody,clone OTI5C3

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
MRP2 (ABCC2) Mouse Monoclonal Antibody [Clone ID: OTI5C3]
TA812520S

USD 159.00

2 Days

ABCC2 mouse monoclonal antibody,clone OTI5C3

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
MRP2 (ABCC2) Rabbit Polyclonal Antibody
TA890096

USD 407.00

In Stock

Rabbit Polyclonal anti-ABCC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC2
MRP2 (ABCC2) Rabbit Polyclonal Antibody
TA890096S

USD 159.00

In Stock

Rabbit Polyclonal anti-ABCC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC2