Germany
Japan
United Kingdom
China
Rabbit anti-ABCF3 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ABCF3. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ABCF3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCF3 Antibody: synthetic peptide directed towards the N terminal of human ABCF3. Synthetic peptide located within the following region: DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL |
Anti-ABCF3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 518-707 amino acids of human ATP-binding cassette, sub-family F (GCN20), member 3 |
ABCF3 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human ABCF3 (NP_060828.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ABCF3