Antibodies

Jump to Filters
View as table Download
ABHD10 Rabbit Polyclonal Antibody
TA330680

USD 375.00

5 Days

Rabbit Polyclonal Anti-ABHD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABHD10 antibody is: synthetic peptide directed towards the middle region of Human ABHD10. Synthetic peptide located within the following region: CIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDDLADGPQILVGSSLGGW
ABHD10 Rabbit Polyclonal Antibody
TA366195

USD 380.00

4 Weeks

ABHD10 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ABHD10
ABHD10 Rabbit Polyclonal Antibody
TA370548

USD 380.00

4 Weeks

ABHD10 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ABHD10