ABHD10 Rabbit Polyclonal Antibody

CAT#: TA330680

Rabbit Polyclonal Anti-ABHD10 Antibody

Product Images

Host: Rabbit; Target Name: ABHD10; Sample Tissue: THP-1 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ABHD10 antibody is: synthetic peptide directed towards the middle region of Human ABHD10. Synthetic peptide located within the following region: CIRFDYSGVGSSDGNSEESTLGKWRKDVLSIIDDLADGPQILVGSSLGGW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: abhydrolase domain containing 10
• Database Link:
  NP_060864
  Entrez Gene 55347 Human
  UniProt ID Q9NUJ1
• Background: This gene encodes a mitochondrially-localized enzyme that acts in liver cells as a hydrolase. The encoded protein removes glucuronide from mycophenolic acid acyl-glucuronide. There is a pseudogene for this gene on chromosome 6. Alternative splicing results in multiple transcript variants.
• Synonyms: FLJ11342
• Note: Human: 100%; Rabbit: 86%