Antibodies

View as table Download

Rabbit Polyclonal Anti-ABI3BP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABI3BP antibody is: synthetic peptide directed towards the C-terminal region of Human ABI3BP. Synthetic peptide located within the following region: PVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYSECKGKQYVKR

Rabbit Polyclonal Anti-ABI3BP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABI3BP antibody: synthetic peptide directed towards the N terminal of human ABI3BP. Synthetic peptide located within the following region: LINPHHDWTLPSHCPNDRFYTIRYREKDKEKKWIFQICPATETIVENLKP

Anti-ABI3BP Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1020-1034 amino acids of human ABI family, member 3 (NESH) binding protein

Anti-ABI3BP Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1020-1034 amino acids of human ABI family, member 3 (NESH) binding protein

Rabbit Polyclonal Anti-ABI3BP Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ABI3BP

ABI3BP rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ABI3BP

ABI3BP Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-280 of human ABI3BP (NP_056244.2).
Modifications Unmodified