Antibodies

View as table Download

Rabbit Polyclonal antibody to ABO (ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase; transferase B, alpha 1-3-galactosyltransferase))

Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 95 and 299 of ABO

ABO Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABO

Rabbit Polyclonal Anti-Abo Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Abo antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GVEILSTFFGTLHPGFYSSSREAFTYERRPQSQAYIPWDRGDFYYGGAFF

Rabbit Polyclonal Anti-ABO Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABO

ABO rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ABO