Antibodies

Jump to Filters
View as table Download
ACAP3 Rabbit Polyclonal Antibody
TA340202

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CENTB5 antibody: synthetic peptide directed towards the N terminal of human CENTB5. Synthetic peptide located within the following region: LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA
ACAP3 Rabbit Polyclonal Antibody
TA357047

USD 360.00

5 Days

ACAP3 Antibody - Middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the Middle region of Human ACAP3