Rabbit Polyclonal Anti-ACBD5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACBD5 Antibody: synthetic peptide directed towards the N terminal of human ACBD5. Synthetic peptide located within the following region: ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK |
Rabbit Polyclonal Anti-ACBD5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACBD5 Antibody: synthetic peptide directed towards the C terminal of human ACBD5. Synthetic peptide located within the following region: VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR |
ACBD5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 170-440 of human ACBD5 (NP_663736.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China