ACBD5 Rabbit Polyclonal Antibody

CAT#: TA335955

Rabbit Polyclonal Anti-ACBD5 Antibody

Product Images

WB Suggested Anti-ACBD5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ACBD5 Antibody: synthetic peptide directed towards the N terminal of human ACBD5. Synthetic peptide located within the following region: ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: acyl-CoA binding domain containing 5
• Database Link:
  NP_001035938
  Entrez Gene 91452 Human
  UniProt ID Q5T8D3
• Background: ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known.
• Synonyms: DKFZp434A2417; KIAA1996
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transmembrane