Antibodies

Jump to Filters
View as table Download
ACRBP Rabbit Polyclonal Antibody
TA344280

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACRBP Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACRBP antibody is: synthetic peptide directed towards the N-terminal region of Human ACRBP. Synthetic peptide located within the following region: KVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLR
ACRBP Rabbit Polyclonal Antibody
TA315919

USD 345.00

In Stock

Rabbit polyclonal anti-ACRBP antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACRBP.