ACRBP Rabbit Polyclonal Antibody

CAT#: TA344280

Rabbit Polyclonal Anti-ACRBP Antibody - N-terminal region


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of acrosin binding protein (ACRBP)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "ACRBP"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-ACRBP antibody is: synthetic peptide directed towards the N-terminal region of Human ACRBP. Synthetic peptide located within the following region: KVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLR
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 59 kDa
Gene Name acrosin binding protein
Background The protein encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and condensation of the acrosin zymogen in the acrosomal matrix. This protein is a member of the cancer/testis family of antigens and it is found to be immunogenic. In normal tissues, this mRNA is expressed only in testis, whereas it is detected in a range of different tumor types such as bladder, breast, lung, liver, and colon.
Synonyms CT23; OY-TES-1; SP32
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 86%; Horse: 86%; Pig: 79%; Bovine: 79%
Reference Data
Protein Families Secreted Protein

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.