ACRBP Rabbit Polyclonal Antibody

CAT#: TA344280

Rabbit Polyclonal Anti-ACRBP Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: ACRBP; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ACRBP antibody is: synthetic peptide directed towards the N-terminal region of Human ACRBP. Synthetic peptide located within the following region: KVLLLPLAPAAAQDSTQASTPGSPLSPTEYERFFALLTPTWKAETTCRLR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: acrosin binding protein
• Database Link:
  NP_115878
  Entrez Gene 84519 Human
  UniProt ID Q8NEB7
• Background: The protein encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and condensation of the acrosin zymogen in the acrosomal matrix. This protein is a member of the cancer/testis family of antigens and it is found to be immunogenic. In normal tissues, this mRNA is expressed only in testis, whereas it is detected in a range of different tumor types such as bladder, breast, lung, liver, and colon.
• Synonyms: CT23; OY-TES-1; SP32
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Dog: 86%; Horse: 86%; Pig: 79%; Bovine: 79%

Reference Data

• Protein Families: Secreted Protein