Rabbit Polyclonal Anti-ACTRT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTRT1 antibody: synthetic peptide directed towards the middle region of human ACTRT1. Synthetic peptide located within the following region: DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR |
Rabbit Polyclonal Anti-ACTRT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTRT1 antibody: synthetic peptide directed towards the middle region of human ACTRT1. Synthetic peptide located within the following region: DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR |
Anti-ACTRT1 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human actin-related protein T1 |
Germany
Japan
United Kingdom
China
