Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ACVR1C (ALK7) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 155 of mouse ALK-7 |
Rabbit Polyclonal Anti-ACVR1C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACVR1C antibody: synthetic peptide directed towards the N terminal of human ACVR1C. Synthetic peptide located within the following region: QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP |
Anti-ACVR1C Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 195-485 amino acids of human activin A receptor, type IC |
ACVR1C Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 22-113 of human ACVR1C (NP_660302.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ACVR1C