Antibodies

Jump to Filters
View as table Download
ACYP1 Rabbit Polyclonal Antibody
TA323229

USD 345.00

In Stock

Anti-ACYP1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-99 amino acids of human acylphosphatase 1, erythrocyte (common) type
ACYP1 Goat Polyclonal Antibody
TA303184

USD 375.00

5 Days

Goat Polyclonal Antibody against ACYP1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PKSHIDKANFNNEK, from the internal region of the protein sequence according to NP_001098.1.
ACYP1 Rabbit Polyclonal Antibody
TA334096

USD 375.00

5 Days

Rabbit Polyclonal Anti-ACYP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACYP1 Antibody is: synthetic peptide directed towards the middle region of Human ACYP1. Synthetic peptide located within the following region: LVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEK
ACYP1 Rabbit Polyclonal Antibody
TA323230

USD 345.00

In Stock

Anti-ACYP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-99 amino acids of human acylphosphatase 1, erythrocyte (common) type