ACYP1 Rabbit Polyclonal Antibody

CAT#: TA334096

Rabbit Polyclonal Anti-ACYP1 Antibody

Product Images

WB Suggested Anti-ACYP1 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ACYP1 Antibody is: synthetic peptide directed towards the middle region of Human ACYP1. Synthetic peptide located within the following region: LVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 11 kDa
• Gene Name: acylphosphatase 1
• Database Link:
  NP_001098
  Entrez Gene 97 Human
  UniProt ID P07311
• Background: Acylphosphatase is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase, on the basis of their tissue localization. This gene encodes the erythrocyte acylphosphatase isoenzyme. Alternatively spliced transcript variants that encode different proteins were identified through data analysis.
• Synonyms: ACYPE
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Guinea pig: 85%

Reference Data

• Protein Pathways: Pyruvate metabolism