Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-ADAMDEC1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADAMDEC1. |
Rabbit Polyclonal Anti-ADAMDEC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADAMDEC1 antibody: synthetic peptide directed towards the middle region of human ADAMDEC1. Synthetic peptide located within the following region: GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL |
Anti-ADAMDEC1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 206-340 amino acids of human ADAM-like, decysin 1 |
ADAMDEC1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 206-470 of human ADAMDEC1 (NP_055294.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- ADAMDEC1