Rabbit Polyclonal Anti-AFM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AFM antibody: synthetic peptide directed towards the C terminal of human AFM. Synthetic peptide located within the following region: HADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCC |
AFM (N-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 55~85 amino acids from the N-terminal region of human AFM |
Goat Anti-Afamin / alpha Albumin Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NKDDRPKDLSLRE, from the internal region of the protein sequence according to NP_001124.1. |
Rabbit Polyclonal Anti-AFM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AFM antibody: synthetic peptide directed towards the middle region of human AFM. Synthetic peptide located within the following region: GQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSR |
AFM Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-599 of human AFM (NP_001124.1). |
| Modifications | Unmodified |
AFM Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260-599 of human AFM (NP_001124.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China