Rabbit Polyclonal Anti-EIF2C4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF2C4 antibody: synthetic peptide directed towards the middle region of human EIF2C4. Synthetic peptide located within the following region: DGHPSRYCATVRVQTSRQEISQELLYSQEVIQDLTNMVRELLIQFYKSTR |
Rabbit Polyclonal Anti-AGO4 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human AGO4 |
Rabbit Polyclonal Anti-AGO4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human AGO4 |
Germany
Japan
United Kingdom
China