Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against AICDA
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RRKFLYQFKNVR-C, from the N Terminus of the protein sequence according to NP_065712.1. |
Rabbit Polyclonal Anti-AICDA Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human AICDA |
AICDA Antibody N-terminal region
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT |
AICDA Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 17-130 of human AICDA (NP_065712.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- AICDA