Germany
Japan
United Kingdom
China
Goat Anti-ALDH18A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SEHGSLKYLH, from the C Terminus of the protein sequence according to NP_002851.2; NP_001017423.1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-ALDH18A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ALDH18A1 Antibody: synthetic peptide directed towards the N terminal of human ALDH18A1. Synthetic peptide located within the following region: SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTR |
ALDH18A1 Rabbit polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Modifications | Unmodified |
Active filters
Target Symbol
- ALDH18A1