Antibodies

Jump to Filters
View as table Download
Aldolase C (ALDOC) Rabbit Polyclonal Antibody
TA346596

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALDOC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDOC antibody: synthetic peptide directed towards the N terminal of human ALDOC. Synthetic peptide located within the following region: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE
Aldolase C (ALDOC) Rabbit Polyclonal Antibody
TA346597

USD 475.00

5 Days

Rabbit Polyclonal Anti-ALDOC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDOC antibody: synthetic peptide directed towards the C terminal of human ALDOC. Synthetic peptide located within the following region: CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA
Aldolase C (ALDOC) (C-term) Rabbit Polyclonal Antibody
AP22780PU-N

USD 440.00

2 Weeks

Aldolase C (ALDOC) (C-term) rabbit polyclonal antibody, Ig Fraction

Applications IHC, WB
Reactivities Human
Immunogen ALDOC antibody was raised against kLH conjugated synthetic peptide selected from the C-terminal region of Human ALDOC.
Epitope: C-Terminus
Aldolase C (ALDOC) (N-term) Rabbit Polyclonal Antibody
AP50143PU-N

USD 512.00

2 Weeks

Aldolase C (ALDOC) (N-term) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of human ALDOC.
Aldolase C (ALDOC) Mouse Monoclonal Antibody [Clone ID: 859CT9.5.3]
TA324945

USD 512.00

5 Days

Mouse monoclonal ALDOC Antibody (C-term)(Ascites)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Aldolase C (ALDOC) Rabbit Polyclonal Antibody
TA373451

USD 410.00

3 Weeks

ALDOC Rabbit polyclonal Antibody

Applications ELISA, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Unmodified