Aldolase C (ALDOC) Rabbit Polyclonal Antibody

CAT#: TA346596

Rabbit Polyclonal Anti-ALDOC Antibody

Product Images

WB Suggested Anti-ALDOC Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALDOC antibody: synthetic peptide directed towards the N terminal of human ALDOC. Synthetic peptide located within the following region: MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: aldolase, fructose-bisphosphate C
• Database Link:
  NP_005156
  Entrez Gene 230 Human
  UniProt ID P09972
• Background: This gene encodes a member of the the CELF/BRUNOL protein family, which contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing and translation. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012]
• Synonyms: ALDC
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%

Reference Data

• Protein Pathways: Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway