Antibodies

View as table Download

ALG10 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 17~43 amino acids from the N-terminal region of human ALG10

Rabbit Polyclonal Anti-ALG10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALG10 antibody is: synthetic peptide directed towards the middle region of Human ALG10. Synthetic peptide located within the following region: AVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSM