Germany
Japan
United Kingdom
China
Rabbit anti-APBB1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human APBB1 |
Antibodies
View as table Download
Goat Polyclonal Antibody against APBB1 / FE65
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-GSLKPKRLGAHTP, from the C Terminus of the protein sequence according to NP_001155.1; NP_663722.1. |
Rabbit polyclonal Anti-Apbb1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Apbb1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDTDSFWNP |
Carrier-free (BSA/glycerol-free) APBB1 mouse monoclonal antibody,clone OTI1G6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) APBB1 mouse monoclonal antibody,clone OTI7E3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
APBB1 mouse monoclonal antibody,clone OTI1G6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
APBB1 mouse monoclonal antibody,clone OTI1G6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
APBB1 mouse monoclonal antibody,clone OTI1G6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
APBB1 mouse monoclonal antibody,clone OTI1G6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
APBB1 mouse monoclonal antibody,clone OTI7E3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
APBB1 mouse monoclonal antibody,clone OTI7E3, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
APBB1 mouse monoclonal antibody,clone OTI7E3, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
APBB1 mouse monoclonal antibody,clone OTI7E3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- APBB1