Germany
Japan
United Kingdom
China
USD 480.00
2 Weeks
Antibodies
View as table Download
USD 480.00
2 Weeks
Apolipoprotein A II (APOA2) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Human Apo AII |
Rabbit Polyclonal Anti-APOA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME |
Rabbit polyclonal anti-APOA2 antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This APOA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-56 amino acids from the Central region of human APOA2. |
Apolipoprotein A2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apolipoprotein A2 (NP_001634.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- APOA2